MINPP1 Recombinant monoclonal antibody

• 

  WB analysis using 87117-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87117-4-RR (MINPP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 87117-4-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using MINPP1 antibody (87117-4-RR, Clone: 252434D11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

MINPP1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 87117-4-RR

Clone No.252434D11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

HIPER1, Ins(1,3,4,5)P(4) 3 phosphatase, MINPP2, MIPP

---

Tested Applications

• Positive WB detected in: SW480 cells, K-562 cells, HEK-293 cells, HepG2 cells, PANC-1 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87117-4-RR targets MINPP1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34998

  Product name: Recombinant human MINPP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-339 aa of BC032504

  Sequence: MLRAPGCLLRTSVAPAAALAAALLSSLARCSLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTL

• Full Name: multiple inositol polyphosphate histidine phosphatase, 1
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC032504
• Gene Symbol: MINPP1
• Gene ID (NCBI): 9562
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UNW1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MINPP1 (multiple inositol-polyphosphate phosphatase 1), also known as MIPP and MINPP2, is an enzyme that catalyzes the removal of the 3-phosphate group from inositol phosphate substrates. It plays a crucial role in the metabolism of inositol polyphosphates, which are important second messengers in cellular signaling pathways. MINPP1 has been implicated in various diseases, including certain types of cancer, where its expression levels may be associated with tumor progression and differentiation.