MIOS Recombinant monoclonal antibody, PBS Only

MIOS Uni-rAb® Recombinant Antibody for IF/ICC, Indirect ELISA
Cat No. 83856-4-PBS
Clone No.240832D12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Indirect ELISA

Missing oocyte meiosis regulator homolog, GATOR2 complex protein MIOS, 240832D12

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83856-4-PBS targets MIOS in IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag15148

Product name: Recombinant human MIOS protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 188-537 aa of BC005883

Sequence: AVALFNLDIRRAIQILNEGASSEKGDLNLNVVAMALSGYTDEKNSLWREMCSTLRLQLNNPYLCVMFAFLTSETGSYDGVLYENKVAVRDRVAFACKFLSDTQLNRYIEKLTNEMKEAGNLEGILLTGLTKDGVDLMESYVDRTGDVQTASYCMLQGSPLDVLKDERVQYWIENYRNLLDAWRFWHKRAEFDIHRSKLDPSSKPLAQVFVSCNFCGKSISYSCSAVPHQGRGFSQYGVSGSPTKSKVTSCPGCRKPLPRCALCLINMGTPVSSCPGGTKSDEKVDLSKDKKLAQFNNWFTWCHNCRHGGHAGHMLSWFRDHAECPVSACTCKCMQLDTTGNLVPAETVQP

Predict reactive species
Full Name missing oocyte, meiosis regulator, homolog (Drosophila)
Calculated Molecular Weight 875 aa, 99 kDa
GenBank Accession NumberBC005883
Gene Symbol MIOS
Gene ID (NCBI) 54468
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ9NXC5
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The mechanistic target of rapamycin complex 1 (mTORC1) controls growth by regulating anabolic and catabolic processes in response to environmental cues, including nutrients. Amino acids signal to mTORC1 through the Rag GTPases, which are regulated by several protein complexes, including GATOR1 and GATOR2. GATOR2, which has five components (WDR24, MIOS, WDR59, SEH1L, SEC13), is required for amino acids to activate mTORC1. PMID: 3583151

Loading...
||
New chat Able
正在加载,请稍候...