MIP Polyclonal antibody

MIP Polyclonal Antibody for WB, ELISA

Cat No. 17977-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

AQP0, Aquaporin 0, LIM1, MIP, MIP26, MP26

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

Freight/Packing: -

Quantity

- +

Filter: AllWB

WB analysis of mouse eye using 17977-1-AP
mouse eye tissue were subjected to SDS PAGE followed by western blot with 17977-1-AP (MIP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse eye using 17977-1-AP
mouse eye tissue were subjected to SDS PAGE followed by western blot with 17977-1-AP (MIP antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse skeletal muscle using 17977-1-AP
mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 17977-1-AP (MIP antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Positive WB detected in

mouse eye tissue, mouse skeletal muscle tissue

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

17977-1-AP targets MIP in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag12369 Product name: Recombinant human MIP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 179-263 aa of BC074913 Sequence: TGAGMNPARSFAPAILTGNFTNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSISERLSVLKGAKPDVSNGQPEVTGEPVELNTQAL Predict reactive species
Full Name	major intrinsic protein of lens fiber
Calculated Molecular Weight	263 aa, 28 kDa
Observed Molecular Weight	26-28 kDa
GenBank Accession Number	BC074913
Gene Symbol	MIP
Gene ID (NCBI)	4284
RRID	AB_10896454
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P30301
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Product Specific Protocols
WB protocol for MIP antibody 17977-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Species	Application	Title
		Biochim Biophys Acta Mol Cell Biol Lipids HSF4 promotes lipid peroxidation by transcriptionally regulating ALOX15 during lens terminal differentiation. Authors - Shaoli Zhang View Article