MITD1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68367-1-Ig (same clone as 68367-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68367-1-Ig (MITD1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 68367-1-PBS in a different storage buffer formulation.

MITD1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68367-1-PBS

Clone No.1F11E2

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

WB, Indirect ELISA

Synonyms

MITD1

---

Product Information

68367-1-PBS targets MITD1 in WB, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11237

  Product name: Recombinant human MITD1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-249 aa of BC018453

  Sequence: MAKSGLRQDPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCNLREKISKYMDRAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWIEDPYIRHTHQLYNFLRFCEMLIKRPCKVKTIHLLTSLDEGIEQVQQSRGLQEIEESLRSHGVLLEVQYSSSIHDREIRFNNGWMIKIGRGLDYFKKPQSRFSLGYCDFDLRPCHETTVDIFHKKHTKNI

• Full Name: MIT, microtubule interacting and transport, domain containing 1
• Calculated Molecular Weight: 249 aa, 29 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC018453
• Gene Symbol: MITD1
• Gene ID (NCBI): 129531
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8WV92
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.