MKRN1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MKRN1 Polyclonal antibody, PBS Only (12773-1-PBS)

• 

  WB analysis using 12773-1-AP (same clone as 12773-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12773-1-AP (MKRN1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12773-1-PBS in a different storage buffer formulation.

MKRN1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 12773-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

RNF61, RING-type E3 ubiquitin transferase makorin-1, RING finger protein 61, makorin ring finger protein 1, EC:2.3.2.27

---

Product Information

12773-1-PBS targets MKRN1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3465

  Product name: Recombinant human MKRN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-349 aa of BC025955

  Sequence: MAEAATPGTTATTSGAGAAAATAAAASPTPIPTVTAPSLGAGGGGGGSDGSGGGWTKQVTCRYFMHGVCKEGDNCRYSHDLSDSPYSVVCKYFQRGYCIYGDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAESRNSNFATVGAGSEDWVNAIEFVPGQPYCGRTAPSCTEAPLQGSVTKEESEKEQTAVETKKQLCPYAAVGECRYGENCVYLHGDSCDMCGLQLLHPMDAAQRSQHIKSCIEAHEKDMELSFAVQRSKDMVCGICMEVVYEKANPSERRFGILSNCNHTYCLKCIRKWRSAKQFESKIIKSCPECRITSNFVIPSEYWVE

• Full Name: makorin ring finger protein 1
• Calculated Molecular Weight: 482 aa, 53 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC025955
• Gene Symbol: MKRN1
• Gene ID (NCBI): 23608
• RRID: AB_3741835
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHC7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.