MLC1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MLC1 Polyclonal antibody (26038-1-AP)

MLC1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 26038-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

KIAA0027, LVM, Megalencephalic leukoencephalopathy with subcortical cysts protein 1, Membrane protein MLC1, MLC

• 

  WB analysis using 26038-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26038-1-AP (MLC1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of THP-1 using 26038-1-AP

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using MLC1 antibody (26038-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MLC1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain
• Positive IF/ICC detected in: THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26038-1-AP targets MLC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23187

  Product name: Recombinant human MLC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 325-377 aa of BC028425

  Sequence: QCVRFKVSARLQGASWDTQNGPQERLAGEVARSPLKEFDKEKAWRAVVVQMAQ

• Full Name: megalencephalic leukoencephalopathy with subcortical cysts 1
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC028425
• Gene Symbol: MLC1
• Gene ID (NCBI): 23209
• RRID: AB_3669518
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15049
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MLC1 Polyclonal antibody (Cat# 26038-1-AP) has 4 total citations published in J Agric Food Chem, Ecotoxicol Environ Saf, Eur J Pharmacol, and J Med Food. The associated research fields include inflammatory bowel disease (ulcerative colitis and intestinal barrier dysfunction), myocardial fibrosis, and osteoarthritis (chondrocyte dedifferentiation), all centered on the RhoA/ROCK/MLC signaling pathway.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		J Agric Food Chem; Atractylenolide-1 Alleviates Ulcerative Colitis via Restraining RhoA/ROCK/MLC Pathway-Mediated Intestinal Barrier Dysfunction; Authors - Zengxiang Gao
rat	WB	Ecotoxicol Environ Saf; Nonylphenol exposure induces myocardial fibrosis via the RhoA/ROCK1/MLC-signaling pathway; Authors - Mucong Zheng
human	IF	Eur J Pharmacol; PDGF-BB inhibits F-actin formation and chondrocyte dedifferentiation in osteoarthritis via oxygen-dependent HIF-1α/SCIN regulation and RhoA/ROCK signaling inhibition.; Authors - Zhenghao Wang
mouse, human	WB,IHC	J Med Food; Ethanolic Extract of Atractylodis Rhizoma Ameliorates DSS-Induced Ulcerative Colitis via Improving Intestinal Barrier Function Through the Rho-Associated Kinase/Myosin Light Chain Pathway.; Authors - Zengxiang Gao