MLF2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MLF2 Polyclonal antibody (11835-1-AP)

MLF2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11835-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

MLF 2, Myelodysplasia-myeloid leukemia factor 2, Myeloid leukemia factor 2, NTN4

• 

  WB analysis of human brain using 11835-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11835-1-AP (MLF2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 11835-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11835-1-AP (MLF2 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 11835-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11835-1-AP (MLF2 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 11835-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 11835-1-AP (MLF2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MLF2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human brain tissue
• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11835-1-AP targets MLF2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2270

  Product name: Recombinant human MLF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-248 aa of BC000898

  Sequence: MFRFMRDVEPEDPMFLMDPFAIHRQHMSRMLSGGFGYSPFLSITDGNMPGTRPASRRMQQAGAVSPFGMLGMSGGFMDMFGMMNDMIGNMEHMTAGGNCQTFSSSTVISYSNTGDGAPKVYQETSEMRSAPGGIRETRRTVRDSDSGLEQMSIGHHIRDRAHILQRSRNHRTGDQEERQDYINLDESEAAAFDDEWRRETSRFRQQRPLEFRRLESSGAGGRRAEGPPRLAIQGPEDSPSRQSRRYDW

• Full Name: myeloid leukemia factor 2
• Calculated Molecular Weight: 248 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC000898
• Gene Symbol: MLF2
• Gene ID (NCBI): 8079
• RRID: AB_2235413
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15773
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MLF2 polyclonal antibody (Cat# 11835-1-AP) has 3 citations. These appear in Advanced Science, Journal of the American Society of Nephrology, and Molecular Oncology. The research fields include colorectal carcinogenesis (MLF2's role in p53 regulation), human kidney endothelial cell biology (single-cell transcriptomics), and colorectal cancer metastasis (RyR2/ROS/BACH1 axis). Applications cited are IF and WB in human samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Adv Sci (Weinh); MLF2 Negatively Regulates P53 and Promotes Colorectal Carcinogenesis; Authors - Debao Fang
human	IF	J Am Soc Nephrol; Integrated Single-Cell Transcriptomic Atlas of Human Kidney Endothelial Cells; Authors - Ka Zhang
human	WB	Mol Oncol; Ryanodine receptor 2 promotes colorectal cancer metastasis by the ROS/BACH1 axis; Authors - Tianwei Chen