MLK4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MLK4 Polyclonal antibody, PBS Only (24395-1-PBS)

• 

  WB analysis of HeLa using 24395-1-AP (same clone as 24395-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 24395-1-AP (MLK4 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24395-1-PBS in a different storage buffer formulation.

• 

  IF Staining of C6 using 24395-1-AP (same clone as 24395-1-PBS)

  Immunofluorescent analysis of C6 cells using 24395-1-AP (MLK4 antibody) at dilution of 1:25 and Rhodamine-Goat anti-Rabbit IgG. This data was developed using the same antibody clone with 24395-1-PBS in a different storage buffer formulation.

MLK4 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 24395-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

24395-1-PBS targets MLK4 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18904

  Product name: Recombinant human KIAA1804 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 689-1036 aa of BC136649

  Sequence: WEEAASANAATVSIEMTPTNSLSRSPQRKKTESALYGCTVLLASVALGLDLRELHKAQAAEEPLPKEEKKKREGIFQRASKSRRSASPPTSLPSTCGEASSPPSLPLSSALGILSTPSFSTKCLLQMDSEDPLVDSAPVTCDSEMLTPDFCPTAPGSGREPALMPRLDTDCSVSRNLPSSFLQQTCGNVPYCASSKHRPSHHRRTMSDGNPTPTGATIISATGASALPLCPSPAPHSHLPREVSPKKHSTVHIVPQRRPASLRSRSDLPQAYPQTAVSQLAQTACVVGRPGPHPTQFLAAKERTKSHVPSLLDADVEGQSRDYTVPLCRMRSKTSRPSIYELEKEFLS

• Full Name: mixed lineage kinase 4
• Calculated Molecular Weight: 1036 aa, 114 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC136649
• Gene Symbol: MLK4
• Gene ID (NCBI): 84451
• RRID: AB_2879522
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5TCX8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MLK4 belongs to the MAP kinase kinase kinase subfamily. The MLK family members are characterized by the presence of signature sequences ofSer/Thr and Tyr kinases within their catalytic domain. The MLK1-4 contains an aminoterminal Src-Homology (SH3) domain, followed by the kinase domain, a leucine-zipper region, and a Cdc42/Rac-interactive binding (CRIB) motif. MLK4 expressed in two splicing variants, MLK4α and MLK4β. The difference of these two isoforms is located in their C-terminal portion. The negative effect of MLK4 on LPS-induced ERK and JNK activation could be very important in controlling the level of cytokine expression, and thus maintaining the balance of inflammatory responses.(PMID:21602844). This protein has 3 isoforms produced by alternative splicing with the molecular weight of 63 kDa, 113 kDa, 53 kDa.