MLL4 Recombinant monoclonal antibody

• 

  IHC staining of human ovary cancer using 84410-3-RR

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 84410-3-RR (MLL4 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 84410-3-RR

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 84410-3-RR (MLL4 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 84410-3-RR

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using MLL4 antibody (84410-3-RR, Clone: 241819G9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  IF Staining of U2OS using 84410-3-RR

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using MLL4 antibody (84410-3-RR, Clone: 241819G9 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 84410-3-RR

  Biolayer interferometry (BLl) kinetic assays of 84410-3-RR against Human MLL4 were performed. The affinity constant is 0.909 nM.

MLL4 Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, ELISA

Cat No. 84410-3-RR

Clone No.241819G9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, ELISA

Synonyms

241819G9, CXXC10 , DYT28, HRX2, KIAA0304

---

Tested Applications

• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84410-3-RR targets MLL4 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35385

  Product name: Recombinant human MLL4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 800-982 aa of BC009337

  Sequence: KVQLFKIDQQQQQKVAASMPLSPGGQMEEVAGAVKQISDRGPVRSEDESVEAKRERPSGPESPVQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRDRQDLATEDTSSASETESVPSRSRRGKVEAAGPGGESEPTGSGGTLAHTPRRSLPSHHGKKMRMARCGHCRGCLRVQDCGSCV

• Full Name: myeloid/lymphoid or mixed-lineage leukemia 4
• GenBank Accession Number: BC009337
• Gene Symbol: MLL4
• Gene ID (NCBI): 9757
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9UMN6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.