MLLT11 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MLLT11 Polyclonal antibody, PBS Only (12062-1-PBS)

• 

  WB analysis using 12062-1-AP (same clone as 12062-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12062-1-AP (MLLT11 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12062-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 12062-1-AP (same clone as 12062-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12062-1-AP (MLLT11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12062-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 12062-1-AP (same clone as 12062-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12062-1-AP (MLLT11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12062-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 12062-1-AP (same clone as 12062-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12062-1-AP (MLLT11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12062-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 12062-1-AP (same clone as 12062-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 12062-1-AP (MLLT11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12062-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 12062-1-AP (same clone as 12062-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 12062-1-AP (MLLT11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12062-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 12062-1-AP (same clone as 12062-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using MLLT11 antibody (12062-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 12062-1-PBS in a different storage buffer formulation.

MLLT11 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 12062-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

AF1Q, Protein AF1q, RP11 316M1.10

---

Product Information

12062-1-PBS targets MLLT11 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2699

  Product name: Recombinant human MLLT11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-90 aa of BC009624

  Sequence: MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFELDLL

• Full Name: myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11
• Calculated Molecular Weight: 90 aa, 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC009624
• Gene Symbol: MLLT11
• Gene ID (NCBI): 10962
• RRID: AB_3741822
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13015
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Mixed-lineage leukemia translocated to 11 (MLLT11), also named ALL1-fused gene from the chromosome 1q (AF1q), which is located in chromosome l band 1q21, has been found to be overexpressed in ovarian cancer and to be associated with a poor patient outcome (PMID: 28423573). It is reported that MLLT11 is a pan-neuronal marker, suggesting a role in neural differentiation in the central nervous system and neural crest-cell derived peripheral ganglia (PMID: 24839873).