Product Information
12062-1-PBS targets MLLT11 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2699 Product name: Recombinant human MLLT11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC009624 Sequence: MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFELDLL Predict reactive species |
| Full Name | myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11 |
| Calculated Molecular Weight | 90 aa, 10 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC009624 |
| Gene Symbol | MLLT11 |
| Gene ID (NCBI) | 10962 |
| RRID | AB_3741822 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13015 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Mixed-lineage leukemia translocated to 11 (MLLT11), also named ALL1-fused gene from the chromosome 1q (AF1q), which is located in chromosome l band 1q21, has been found to be overexpressed in ovarian cancer and to be associated with a poor patient outcome (PMID: 28423573). It is reported that MLLT11 is a pan-neuronal marker, suggesting a role in neural differentiation in the central nervous system and neural crest-cell derived peripheral ganglia (PMID: 24839873).













