MLXIPL Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MLXIPL Polyclonal antibody (33703-1-AP)

MLXIPL Polyclonal Antibody for WB, IHC, ELISA

Cat No. 33703-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

ChREBP, BHLHD14, Carbohydrate-responsive element-binding protein, Class D basic helix-loop-helix protein 14, MIO

• 

  WB analysis using 33703-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33703-1-AP (MLXIPL antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 33703-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 33703-1-AP (MLXIPL antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: K-562 cells, mouse kidney tissue, rat kidney tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33703-1-AP targets MLXIPL in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37912

  Product name: Recombinant human MLXIPL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 800-852 aa of NM_032951

  Sequence: AWLDQYCSLPALRPTVLNSLRQLGTSTSILTDPGRIPEQATRAVTEGTLGKPL

• Full Name: MLX interacting protein-like
• Calculated Molecular Weight: 93 kDa
• Observed Molecular Weight: 78 kDa
• GenBank Accession Number: NM_032951
• Gene Symbol: MLXIPL
• Gene ID (NCBI): 51085
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9NP71
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Carbohydrate response element-binding protein (ChREBP), also known as MLXIPL, is a glucose-responsive transcription factor that has a fundamental role in the glucose-mediated induction of genes involved in hepatic glycolysis and lipogenesis. Circulating blood glucose levels affect ChREBP activity in hepatocytes largely by post-translational mechanisms that include phosphorylation-dependent subcellular localization [PMID:21665952]. It enhances expression of the liver pyruvate kinase (LPK) gene and all lipogenic enzyme genes resulting in the conversion of excess dietary carbohydrate into triglycerides that can be stored as fat [PMID:15118080]. Molecular Weight of ChREBP splice variants: 62/78/91/93 kDa.