• Featured Product
  • KD/KO Validated

MLYCD Polyclonal antibody

MLYCD Polyclonal Antibody for WB, IP, IHC, ELISA
Cat No. 15265-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

malonyl CoA decarboxylase, MCD, MLYCD

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman testis tissue
Positive IP detected inmouse liver tissue
Positive IHC detected inhuman kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2400
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15265-1-AP targets MLYCD in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7334

Product name: Recombinant human MLYCD protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 103-454 aa of BC000286

Sequence: HHISKLDGGVRFLVQLRADLLEAQALKLVEGPDVREMNGVLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISEAEAVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGEPLVVLHVALTGDISSNIQAIVKEHPPSETEEKNKITAAIFYSISLTQQGLQGVELGTFLIKRVVKELQREFPHLGVFSSLSPIPGFTKWLLGLLNSQTKEHGRNELFTDSECKEISEITGGPINETLKLLLSSSEWVQSEKLVRALQTPLMRLCAWYLYGEKHRGYALNPVANFHLQNGAVLWRINWMADVSLRGITGSCGLMANYRYFLEETGPNSTSYLGSKIIKASEQVLSLVAQFQKNSKL

Predict reactive species
Full Name malonyl-CoA decarboxylase
Calculated Molecular Weight 55 kDa
Observed Molecular Weight 50-60 kDa
GenBank Accession NumberBC000286
Gene Symbol MLYCD
Gene ID (NCBI) 23417
RRIDAB_2146403
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO95822
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MLYCD, also named as MCD, is a 50-55 kDa protein. It is an enzyme that catalyzes the conversion of malonyl-CoA to acetyl-CoA. In the fatty acid biosynthesis MCD selectively removes malonyl-CoA and thus assures that methyl-malonyl-CoA is the only chain elongating substrate for fatty acid synthase and that fatty acids with multiple methyl side chains are produced. In peroxisomes it may be involved in degrading intraperoxisomal malonyl-CoA, which is generated by the peroxisomal beta-oxidation of odd chain-length dicarboxylic fatty acids. 66 kDa MLYCD protein has been identified in normal cell lines. Some patients give the 68-83 kDa smeary band. (PMID:12955715)

Protocols

Product Specific Protocols
IHC protocol for MLYCD antibody 15265-1-APDownload protocol
IP protocol for MLYCD antibody 15265-1-APDownload protocol
WB protocol for MLYCD antibody 15265-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Hepatology

Acetyl-CoA carboxylase α promotion of glucose-mediated fatty acid synthesis enhances survival of hepatocellular carcinoma in mice and patients.

Authors - Ming-Da Wang
mouseWB

Proc Natl Acad Sci U S A

Ribosomal protein-Mdm2-p53 pathway coordinates nutrient stress with lipid metabolism by regulating MCD and promoting fatty acid oxidation.

Authors - Yong Liu
mouseWB

Cell Rep

Acetyl-CoA carboxylase 1 is a suppressor of the adipocyte thermogenic program

Authors - Adilson Guilherme
  • KO Validated

PLoS Pathog

Integrated systems biology analysis of KSHV latent infection reveals viral induction and reliance on peroxisome mediated lipid metabolism.

Authors - Zoi E Sychev
ratWB

Int J Mol Sci

The Impact of Nicotine along with Oral Contraceptive Exposure on Brain Fatty Acid Metabolism in Female Rats

Authors - Shahil H Patel
mouseWB

J Mol Cell Cardiol

C-Myc induced compensated cardiac hypertrophy increases free fatty acid utilization for the citric acid cycle.

Authors - Olson Aaron K AK

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Hua (Verified Customer) (11-14-2024)

I did not see a band around 55 kDa on WB.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mouse liver
MLYCD Antibody Western Blot validation (1:500 dilution) in Mouse liver (Cat no:15265-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...