Use Able AI chat for product recommendations

Neprilysin/CD10 Polyclonal antibody

Neprilysin/CD10 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 10302-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

MME, Neprilysin, Atriopeptidase, CALLA, CD10

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue, HEK-293 cells, rat kidney tissue
Positive IHC detected inhuman kidney tissue, human hepatocirrhosis tissue, human liver cancer tissue, human renal cell carcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 2 publications below

Product Information

10302-1-AP targets Neprilysin/CD10 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, hamster
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0427

Product name: Recombinant human MME,CD10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 52-252 aa of BC101658

Sequence: YDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISV

Predict reactive species
Full Name membrane metallo-endopeptidase
Calculated Molecular Weight 750 aa, 86 kDa
Observed Molecular Weight 90-100 kDa
GenBank Accession NumberBC101658
Gene Symbol CD10
Gene ID (NCBI) 4311
RRIDAB_10640893
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP08473
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD10, also known as neprilysin, membrane metallo-endopeptidase (MME), neutral endopeptidase (NEP), or common acute lymphoblastic leukemia antigen (CALLA), is a 100-kDa type II transmembrane glycoprotein belonging to peptidase M13 family (PMID: 7760013; 8102558). Among hematopoietic cells, CD10 is expressed on granulocytes, B cell precursors, mature germinal center B cells, a subset of immature thymocytes (PMID: 13679451). CD10 is also expressed on a variety of nonhematopoietic cell types, including bronchial epithelial cells, cultured fibroblasts, bone marrow stromal cells, renal proximal tubular epithelial cells, breast myoepithelium, biliary canaliculi (PMID: 8102558). CD10 is a cell surface peptidase that cleaves peptide bonds on the amino side of hydrophobic amino acids and inactivates a variety of physiologically active peptides. Loss or decreases in CD10 expression have been reported in a variety of malignancies (PMID: 16054017).

Protocols

Product Specific Protocols
IF protocol for Neprilysin/CD10 antibody 10302-1-APDownload protocol
IHC protocol for Neprilysin/CD10 antibody 10302-1-APDownload protocol
WB protocol for Neprilysin/CD10 antibody 10302-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

J Pathol

Association of dysfunctional synapse defective 1 (SYDE1) with restricted fetal growth - SYDE1 regulates placental cell migration and invasion.

Authors - Hsiao-Fan Lo
human,hamsterWB

Fitoterapia

A novel peptidoglycan isolated from Semiaquilegia adoxoides inhibits Aβ42 production via activating autophagy

Authors - Saijuan Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Luca (Verified Customer) (09-12-2022)

The antibody unfortunately did not work but most likely the conditions of the WB need optimized.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
FH

Luca (Verified Customer) (06-10-2022)

I unfortunately could not detect a band against this protein even when expressed using a plasmid, but I have to better optimize my conditions. I liked having the facts sheet with me as that was helpful, so thank you for including it with the Ab.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500- 1:1000
FH

Boyan (Verified Customer) (10-27-2021)

This antibody recognised a clean band around 100 kd.

  • Applications: Western Blot
Loading...
||
New chat

Able

正在加载,请稍候...