Tested Applications
| Positive WB detected in | MDA-MB-468 cells, PC-3 cells, SW480 cells, U-251 cells |
| Positive IHC detected in | rat adrenal gland tissue, mouse kidney tissue, human colon cancer tissue, mouse adrenal gland tissue, mouse colon tissue, rat colon tissue, rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31166-1-AP targets MMGT1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag35121 Product name: Recombinant human MMGT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 65-131 aa of BC033588 Sequence: GEFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKLRKLESLRR Predict reactive species |
| Full Name | membrane magnesium transporter 1 |
| Calculated Molecular Weight | 131 aa, 15 kDa |
| Observed Molecular Weight | 15-20 kDa |
| GenBank Accession Number | BC033588 |
| Gene Symbol | MMGT1 |
| Gene ID (NCBI) | 93380 |
| RRID | AB_3742401 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q8N4V1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MMGT1 (Membrane Magnesium Transporter 1) is a protein encoded by the MMGT1 gene in humans. It is also known by the aliases EMC5 and TMEM32. This protein is a member of the magnesium transporter family and is involved in the transport of magnesium ions across cell membranes.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MMGT1 antibody 31166-1-AP | Download protocol |
| WB protocol for MMGT1 antibody 31166-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





















