MMP-9 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• MMP-9 Monoclonal antibody (60600-1-Ig)

MMP-9 Monoclonal Antibody for WB, ELISA

Cat No. 60600-1-Ig Copied!

Clone No. 3C3E2

Publications (5)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, ELISA

Synonyms

MMP9, 67 kDa matrix metalloproteinase-9, 82 kDa matrix metalloproteinase-9, CLG4B, EC:3.4.24.35

• 

  WB analysis using 60600-1-Ig

  Supernatant from non-treated and PMA treated U2OS cells were subjected to SDS PAGE followed by western blot with 60600-1-Ig (MMP-9 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MMP-9 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60600-1-Ig targets MMP-9 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg0442

  Product name: Recombinant Human MMP9 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*His

  Domain: 20-707 aa of BC006093

  Sequence: APRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

• Full Name: matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
• Calculated Molecular Weight: 707 aa, 78 kDa
• Observed Molecular Weight: 92 kDa
• GenBank Accession Number: BC006093
• Gene Symbol: MMP-9
• Gene ID (NCBI): 4318
• RRID: AB_3743224
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P14780
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, tissue remodeling, and disease processes, such as arthritis or metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. Matrix metalloproteinase 9 (gelatinase B, 92 kDa gelatinase, 92 kDa type IV collagenase) (MMP9, synonyms: GELB, CLG4B) degrades collagens type IV and V. Studies in rhesus monkeys suggest that MMP9 is involved in IL-8-induced mobilization hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling (PMID:7492685).

Publications

What published studies show

MMP-9 Monoclonal antibody (3C3E2), catalog number 60600-1-Ig, has 5 total citations published in Aging Dis, Ecotoxicology and Environmental Safety, Scientific Reports, Biomedicines, and Cancer Immunology Research. The cited studies span cardiovascular disease (abdominal aortic aneurysm), acute ischemic stroke, ovarian cancer, lung adenocarcinoma, and pancreatic cancer. Key research themes include M1 macrophage polarization, NF-κB and MAPK signaling pathways, tumor stromal interactions, and extracellular matrix remodeling.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Aging Dis; ATF4 Contributes to Abdominal Aortic Aneurysm Formation via Modulating M1 Macrophage Polarization and Inflammation; Authors - Huahui Yu
		Ecotoxicol Environ Saf; HFPO-DA exacerbates acute ischemic stroke outcomes in rats via the CSNK2A1/GSK3B/NF-κB signaling pathway.; Authors - Fang Jia
human	WB	Sci Rep; CCL8 suppresses ovarian cancer progression via M1 macrophage polarization and NF-κB-mediated apoptosis.; Authors - Jie Fang
human	WB	Biomedicines; REDD1 Affects Proliferation, Apoptosis, Migration, and Colony Formation via p-ERK and p-JNK Signaling in Lung Adenocarcinoma Cells Under Hypoxia.; Authors - Xiaoyu Fang
		Cancer Immunol Res; Periductal Fibroblast Density Defines Lymphocyte Exclusion via a CD44-Dependent Stromal Checkpoint in Pancreatic Cancer.; Authors - Zoe X. Malchiodi