Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22989-1-AP targets MMP12 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, rabbit, canine, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19068 Product name: Recombinant human MMP12 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 231-402 aa of BC112301 Sequence: DPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKENQRLPNPDNSEPALCDPNLSFDAVTTVGNKIFFFKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLISNLRPEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWR Predict reactive species |
| Full Name | matrix metallopeptidase 12 (macrophage elastase) |
| Calculated Molecular Weight | 470 aa, 54 kDa |
| Observed Molecular Weight | 54 kDa, 45 kDa |
| GenBank Accession Number | BC112301 |
| Gene Symbol | MMP12 |
| Gene ID (NCBI) | 4321 |
| RRID | AB_2879193 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P39900 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MMP12(Matrix metalloproteinase-12) is a 54 kDa proenzyme that is processed into a 45 kDa and then a 22 kDa active form(15723202). MMP9 and MMP12 promote intimal thickening by independent cleavage of N-cadherin, which elevates vascular smooth muscle cell proliferation via beta-catenin signalling. Its overexpression in myeloid lineage cells plays a key role in modulating myelopoiesis, immune suppression, and lung tumorigenesis(PMID: 21378275).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for MMP12 antibody 22989-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-MMP12 antibody (Cat# 22989-1-AP) has 53 citations published in journals including Nature Cell Biology, Nature Neuroscience, Nature Communications, Redox Biology, Advanced Science, Biomaterials, Journal of Neuroinflammation, International Journal of Molecular Medicine, and others. Research fields span pulmonary disease/COPD, fibrosis (hepatic, renal, pulmonary), macrophage biology, neuroinflammation, cancer, metabolic disorders, wound healing, and cardiovascular disease.
| Species | Application | Title |
|---|---|---|
Nat Cell Biol Autophagy enables microglia to engage amyloid plaques and prevents microglial senescence | ||
Nat Neurosci Derivation and transcriptional reprogramming of border-forming wound repair astrocytes after spinal cord injury or stroke in mice | ||
Nat Commun Lung-derived HMGB1 is detrimental for vascular remodeling of metabolically imbalanced arterial macrophages. | ||
J Adv Res SLC3A2-mediated BCAAs transport promotes airway inflammation and remodeling in chronic obstructive pulmonary disease via acetylation of PFN1. | ||
Redox Biol Hydrogen sulfide attenuates cigarette smoke-induced airway remodeling by upregulating SIRT1 signaling pathway. | ||
Redox Biol Macrophage AMPK activated by oxidative stress drives profibrotic crosstalk with tubular cells to accelerate renal fibrosis after ischemic and reperfusion injury. |
Reviews
What customers say
Users report consistent performance of this antibody across Western Blot and Immunohistochemistry applications. Typical dilutions range from 1:500 to 1:1000. Reviewers observed clear, specific bands in liver and lung tissues (mouse and human), as well as macrophage-specific positive staining in IHC. One user confirmed successful detection in Caco2 cells and animal colon tissue. Overall ratings average 4.8 out of 5, with most reviewers highlighting strong signal quality and reliable results.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
S (Verified Customer) (01-07-2026) | Good
 |
A (Verified Customer) (07-15-2025) | Used for caco2 cells and animal colon tissue
|
Hongxue (Verified Customer) (01-17-2023) | IHC staining in mouse liver, macrophage specific positive signaling.
 |
Yadavalli (Verified Customer) (07-20-2021) | I had used the MMP12 antibody and detected in the lung tissue which ad shown a significant data
 |
Hongxue (Verified Customer) (01-12-2021) | wb band very good
 |
