MMP12 Monoclonal antibody, PBS Only

• 

  WB analysis using 66930-1-Ig (same clone as 66930-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66930-1-Ig (MMP12 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66930-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 66930-1-Ig (same clone as 66930-1-PBS)

  WB result of MMP12 antibody (66930-1-Ig; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-MMP12 transfected A549 cells. This data was developed using the same antibody clone with 66930-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MMP12 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66930-1-PBS

Clone No.1C6B5

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

HME, Macrophage elastase, Macrophage metalloelastase, Matrix metalloproteinase 12, ME, MME, MMP 12, MMP12

---

Product Information

66930-1-PBS targets MMP12 in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19068

  Product name: Recombinant human MMP12 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 231-402 aa of BC112301

  Sequence: DPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKENQRLPNPDNSEPALCDPNLSFDAVTTVGNKIFFFKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLISNLRPEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWR

• Full Name: matrix metallopeptidase 12 (macrophage elastase)
• Calculated Molecular Weight: 470 aa, 54 kDa
• Observed Molecular Weight: 54 kDa, 45 kDa
• GenBank Accession Number: BC112301
• Gene Symbol: MMP12
• Gene ID (NCBI): 4321
• RRID: AB_2882256
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P39900
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MMP12(Matrix metalloproteinase-12) is a 54 kDa proenzyme that is processed into a 45 kDa and then a 22 kDa active form(15723202). MMP9 and MMP12 promote intimal thickening by independent cleavage of N-cadherin, which elevates vascular smooth muscle cell proliferation via beta-catenin signalling. Its overexpression in myeloid lineage cells plays a key role in modulating myelopoiesis, immune suppression, and lung tumorigenesis(PMID: 21378275).