MMP13 Recombinant monoclonal antibody, PBS Only (Detector)

MMP13 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 83188-2-PBS
Clone No.240060B10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

240060B10, CLG3, Collagenase 3, EC:3.4.24.-, Matrix metalloproteinase 13

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83188-2-PBS targets MMP13 as part of a matched antibody pair:

MP00266-1: 83188-3-PBS capture and 83188-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34892

Product name: Recombinant human MMP13 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 100-471 aa of BC074808

Sequence: DVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC

Predict reactive species
Full Name matrix metallopeptidase 13
Calculated Molecular Weight 471 aa, 54 kDa
Observed Molecular Weight 70 kDa, 54 kDa
GenBank Accession NumberBC074808
Gene Symbol MMP13
Gene ID (NCBI) 4322
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP45452
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MMP-13(Matrix metalloproteinase-13), cleaves type I collagen and was previously thought to be the rodent analogue of human interstitial MMP-1. MMP-13 is found in hypertrophic and calcifying cartilage of mammalian growth plate. The bands seen with rat MMP-13 are consistent with a 59-kDa latent form and a 43-kDa active form reported for this enzyme, along with a smaller band at approximately 30 kDa(PMID:10771523).

Loading...
||
New chat Able
正在加载,请稍候...