MMP13 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83188-4-RR (same clone as 83188-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83188-4-RR (MMP13 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83188-4-PBS in a different storage buffer formulation.

• 

  FC experiment of MCF-7 using 83188-4-RR (same clone as 83188-4-PBS)

  1x10^6 MCF-7 cells were intracellularly stained with 0.25 ug MMP13 Recombinant antibody (83188-4-RR, Clone:240060A1) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83188-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83188-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83188-4-RR against Human MMP13 were performed. The affinity constant is below 1 pM.

MMP13 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 83188-4-PBS

Clone No.240060A1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

Synonyms

240060A1, CLG3, Collagenase 3, EC:3.4.24.-, Matrix metalloproteinase 13

---

Product Information

83188-4-PBS targets MMP13 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34892

  Product name: Recombinant human MMP13 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 100-471 aa of BC074808

  Sequence: DVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC

• Full Name: matrix metallopeptidase 13
• Calculated Molecular Weight: 471 aa, 54 kDa
• Observed Molecular Weight: 70 kDa, 54 kDa
• GenBank Accession Number: BC074808
• Gene Symbol: MMP13
• Gene ID (NCBI): 4322
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P45452
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MMP-13(Matrix metalloproteinase-13), cleaves type I collagen and was previously thought to be the rodent analogue of human interstitial MMP-1. MMP-13 is found in hypertrophic and calcifying cartilage of mammalian growth plate. The bands seen with rat MMP-13 are consistent with a 59-kDa latent form and a 43-kDa active form reported for this enzyme, along with a smaller band at approximately 30 kDa(PMID:10771523). It also can be detected 3 bands that the glycosylated proMMP-13 (70 kDa), unglycosylated form (55 kDa), and active MMP-13 enzyme (40kDa) by western blot(PMID:18332263).