MMP14 / MT1-MMP Polyclonal antibody

• 

  WB analysis using 29111-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 29111-1-AP (MMP14 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 29111-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29111-1-AP (MMP14 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 29111-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29111-1-AP (MMP14 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 29111-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using MMP14 antibody (29111-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

MMP14 / MT1-MMP Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 29111-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

MMP14, EC:3.4.24.80, Matrix metalloproteinase 14, Matrix metalloproteinase-14, Membrane-type matrix metalloproteinase 1

---

Tested Applications

• Positive WB detected in: A549 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 6 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

29111-1-AP targets MMP14 / MT1-MMP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30755

  Product name: Recombinant human MMP14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 356-475 aa of BC064803

  Sequence: PIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFT

• Full Name: matrix metallopeptidase 14 (membrane-inserted)
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 66-70 kDa
• GenBank Accession Number: BC064803
• Gene Symbol: MMP14
• Gene ID (NCBI): 4323
• RRID: AB_2918236
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P50281
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MMP14, also named as MT1-MMP, is a key matrix metalloproteinase (MMP) family member which plays a crucial role in tumor growth, invasion and metastasis. MT1-MMP is a cell membrane-bound proteinase, and it enhances degradation of collagen IV, a major component of the basement membrane, by forming a complex with tissue inhibitor of metalloproteinase-2 (TIMP-2) to activate pro-MMP-2. MT1-MMP can influence venous invasion, intrahepatic metastasis , and patient outcome in hepatocellular carcinoma (HCC). MT1-MMP was reported to be present in centromere and could lead to chromosome instability in MDCK cells, indicating that MT1-MMP may have more novel functions in the intracellular compartments. In western blotting, pro-MMP14 (65 kDa) and MMP14 (51 kDa) bands showed with the truncated MMP14 (45, 42, 35, 20 kDa) forms (PMID:12097451).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Biochem Biophys Res Commun; IPMK depletion influences genome-wide DNA methylation; Authors - Zachary Sin ; KD Validated
human	WB,IF	Front Oncol; Overexpression of MMP14 is associated with poor prognosis and immune cell infiltration in colon cancer; Authors - Na Li
human	WB,IHC	Cancer Lett; Distinct Immunophenotypic Profiles and Neutrophil Heterogeneity in Colorectal Cancer; Authors - Minghua Bai
mouse,human	WB	Appl Biochem Biotechnol; Kunzea Ericoides (Kanuka) Leaf Extracts Show Moisturisation, Antioxidant, and UV Protection Effects in HaCaT Cells and Anti-melanogenesis Effects in B16F10 Cells; Authors - Xuefeng He
mouse	WB	JCI Insight; LRP1 regulates asthmatic airway smooth muscle proliferation through FGF2/ERK signaling; Authors - Ya Deng
mouse,human	WB	Bioact Mater; Biomimetic nanoparticles drive the mechanism understanding of shear-wave elasticity stiffness in triple negative breast cancers to predict clinical treatment; Authors - Dongdong Zheng