• Featured Product
  • KD/KO Validated

MMP2 Monoclonal antibody

MMP2 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 66366-1-Ig
Clone No.2B10D1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, FC (Intra), ELISA

2B10D1, 72 kDa gelatinase, 72 kDa type IV collagenase, CLG4A, EC:3.4.24.24

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU-251 cells, human placenta tissue, MCF-7 cells, pig heart tissue, rat heart tissue, U-87 MG cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman placenta tissue
Positive FC (Intra) detected inHeLa cells, PC-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:150-1:600
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66366-1-Ig targets MMP2 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25039

Product name: Recombinant human MMP2 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 34-469 aa of BC002576

Sequence: IIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEIC

Predict reactive species
Full Name matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)
Calculated Molecular Weight 72 kDa
Observed Molecular Weight 55-74 kDa
GenBank Accession NumberBC002576
Gene Symbol MMP2
Gene ID (NCBI) 4313
RRIDAB_2881746
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP08253
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MMP2, also named as CLG4A, Gelatinase Am, TBE-1 and PEX, belongs to the peptidase M10A family. It is ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. MMP2 contributes to myocardial oxidative stress by regulating the activity of GSK3beta. It cleaves GSK3beta in vitro. MMP2 can be cleaved into PEX chain(~60kd).Western blot analysis showed that the 72 kDa and 62 kDa proteinase activities were pro-MMP2 and the active enzyme,respectively(PMID:11112697).

Protocols

Product Specific Protocols
FC protocol for MMP2 antibody 66366-1-IgDownload protocol
IF protocol for MMP2 antibody 66366-1-IgDownload protocol
IHC protocol for MMP2 antibody 66366-1-IgDownload protocol
WB protocol for MMP2 antibody 66366-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Biomaterials

Macromechanics and polycaprolactone fiber organization drive macrophage polarization and regulate inflammatory activation of tendon in vitro and in vivo.

Authors - Angelina D Schoenenberger
humanWB

Cancer Lett

Direct contact between tumor cells and platelets initiates a FAK-dependent F3/TGF-β positive feedback loop that promotes tumor progression and EMT in osteosarcoma

Authors - Qianyu Shi
ratWB,IF

J Neuroinflammation

SPOCK2 modulates neuropathic pain by interacting with MT1-MMP to regulate astrocytic MMP-2 activation in rats with chronic constriction injury

Authors - Chenglong Wang
ratWB

Int J Nanomedicine

A Novel Liposomal S-Propargyl-Cysteine: A Sustained Release of Hydrogen Sulfide Reducing Myocardial Fibrosis via TGF-β1/Smad Pathway.

Authors - Ba Hieu Tran
humanWB

Bioeng Transl Med

Multistage targeting and dual inhibiting strategies based on bioengineered tumor matrix microenvironment-mediated protein nanocages for enhancing cancer biotherapy.

Authors - Fabiao Hu
humanWB

Aging (Albany NY)

Extracorporeal shockwave relieves endothelial injury and dysfunction in steroid-induced osteonecrosis of the femoral head via miR-135b targeting FOXO1: in vitro and in vivo studies.

Authors - Xinjie Wu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Cassand (Verified Customer) (04-06-2022)

Works good for IHC

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: skin
MMP2 Antibody Immunohistochemistry validation (1:50 dilution) in skin (Cat no:66366-1-Ig)
FH

Ryan (Verified Customer) (02-28-2019)

Tissue was fixed in PFA and no antigen retrieval was used.

  • Applications: Immunohistochemistry, Immunofluorescence,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Zebrafish brain at 3dpf
MMP2 Antibody Immunohistochemistry,Immunofluorescence, validation (1:100 dilution) in Zebrafish brain at 3dpf (Cat no:66366-1-Ig)
FH

Ryan (Verified Customer) (01-10-2018)

  • Applications: Immunohistochemistry,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Retina
MMP2 Antibody Immunohistochemistry, validation (1:100 dilution) in Retina (Cat no:66366-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...