Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated MMP2 Monoclonal antibody

MMP2 Monoclonal Antibody for IF/ICC

Cat No. CL488-66366
Clone No. 2B10D1
Publications (1)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, mouse, pig

Applications

WB, IF/ICC

72 kDa gelatinase, 72 kDa type IV collagenase, CLG4, CLG4A, Gelatinase A, Matrix metalloproteinase 2, MMP 2, MMP II, MMP2, MONA, TBE 1

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for MMP2 in ?

Tested Applications

Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66366 targets MMP2 in WB, IF/ICC applications and shows reactivity with human, rat, mouse, pig samples.

Tested Reactivity human, rat, mouse, pig
Cited Reactivityrat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25039

Product name: Recombinant human MMP2 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 34-469 aa of BC002576

Sequence: IIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEIC

Predict reactive species
Full Name matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)
Calculated Molecular Weight 72 kDa
Observed Molecular Weight 55-74 kDa
GenBank Accession NumberBC002576
Gene Symbol MMP2
Gene ID (NCBI) 4313
RRIDAB_2919317
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP08253
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MMP2, also named as CLG4A, Gelatinase Am, TBE-1 and PEX, belongs to the peptidase M10A family. It is ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. MMP2 contributes to myocardial oxidative stress by regulating the activity of GSK3beta. It cleaves GSK3beta in vitro. MMP2 can be cleaved into PEX chain(~60kd).Western blot analysis showed that the 72 kDa and 62 kDa proteinase activities were pro-MMP2 and the active enzyme,respectively(PMID:11112697).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 MMP2 antibody CL488-66366Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

CL488-66366 is the CoraLite® Plus 488-conjugated MMP2 Monoclonal antibody (clone 2B10D1). It has 1 citation to date, published in Pharmaceutical Biology (Pharm Biol), a journal focused on pharmacology and biomedicine. The cited study investigates how Xijiaqi Formula attenuates myocardial infarction-induced chronic heart failure by inhibiting TGF-β1/Smads-mediated fibroblast activation, placing this citation within the cardiovascular disease and cardiac fibrosis research field. The application used was Western blot in rat samples.

SpeciesApplicationTitle
ratWB

Pharm Biol

Xijiaqi Formula attenuates myocardial infarction-induced chronic heart failure by inhibiting TGF-β1/Smads-mediated fibroblast activation.

Authors - Qian Zhang
Loading...
||
New chat

Able™

正在加载,请稍候...