MMP7 Recombinant monoclonal antibody

• 

  WB analysis using 87552-1-RR

  SKOV-3 cells lysates were subjected to SDS PAGE followed by western blot with 87552-1-RR (MMP7 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 87552-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87552-1-RR (MMP7 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 87552-1-RR

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 87552-1-RR (MMP7 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 87552-1-RR

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 87552-1-RR (MMP7 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

MMP7 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 87552-1-RR

Clone No.252985B7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

EC:3.4.24.23, Matrilysin, Matrin, Matrix metalloproteinase 7, Matrix metalloproteinase-7

---

Tested Applications

• Positive WB detected in: A549 cells, SKOV-3 cells, HT-29 cells
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87552-1-RR targets MMP7 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0550

  Product name: Recombinant human MMP7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of BC003635

  Sequence: MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSHVIEIMQKPRCGVPDVAEYSLFPN

• Full Name: matrix metallopeptidase 7 (matrilysin, uterine)
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 27-30 kDa
• GenBank Accession Number: BC003635
• Gene Symbol: MMP7
• Gene ID (NCBI): 4316
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09237
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Matrix metalloproteinase-7 (MMP-7)/ matrilysin is a member of the MMP family, but is structurally different from the other MMPs by virtue of the absence of a conserved COOH-terminal protein domain. MMPs are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and cancer metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP-7 degrades proteoglycans, fibronectin, elastin and casein, and is involved in wound healing, tumor progression, pulmonary fibrosis, and development of choroidal neovascularization in age-related macular degeneration. The expression of MMP-7 is increased in most tumors.