MMP8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MMP8 Polyclonal antibody (17874-1-AP)

• Featured Product
• KD/KO Validated

MMP8 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 17874-1-AP Copied!

Publications (21)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CLG1, EC:3.4.24.34, HNC, Matrix metalloproteinase 8, Matrix metalloproteinase-8

• 

  WB analysis using 17874-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17874-1-AP (MMP8 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 17874-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 17874-1-AP (MMP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 17874-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 17874-1-AP (MMP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 17874-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 17874-1-AP (MMP8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 17874-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 17874-1-AP (MMP8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 17874-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 17874-1-AP (MMP8 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 17874-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 17874-1-AP (MMP8 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 17874-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 17874-1-AP (MMP8 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 17874-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 17874-1-AP (MMP8 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 17874-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 17874-1-AP (MMP8 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 17874-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 17874-1-AP (MMP8 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary using 17874-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 17874-1-AP (MMP8 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary using 17874-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 17874-1-AP (MMP8 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 17874-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 17874-1-AP (MMP8 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 17874-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 17874-1-AP (MMP8 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 17874-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using MMP8 antibody (17874-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MMP8 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, mouse liver tissue, Jurkat cells, L02 cells
• Positive IHC detected in: human placenta tissue, human kidney tissue, human ovary tissue, human spleen tissue, human testis tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17874-1-AP targets MMP8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12367

  Product name: Recombinant human MMP8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 119-467 aa of BC074988

  Sequence: NYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYGLSSNPIQPTGPSTPKPCDPSLTFDAITTLRGEILFFKDRYFWRRHPQLQRVEMNFISLFWPSLPTGIQAAYEDFDRDLIFLFKGNQYWALSGYDILQGYPKDISNYGFPSSVQAIDAAVFYRSKTYFFVNDQFWRYDNQRQFMEPGYPKSISGAFPGIESKVDAVFQQEHFFHVFSGPRYYAFDLIAQRVTRVARGNKWLNCRYG

• Full Name: matrix metallopeptidase 8 (neutrophil collagenase)
• Calculated Molecular Weight: 467 aa, 53 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC074988
• Gene Symbol: MMP8
• Gene ID (NCBI): 4317
• RRID: AB_2144582
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22894
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MMP8(Matrix metalloproteinase-8) an enzyme that degrades fibrillar collagens imparting strength to the fetal membranes, is expressed by leukocytes and chorionic cytotrophoblast cells(PMID:15367487). Purified human neutrophil MMP-8 with proeMMP-8 at 70-75 KDa and active enzyme at 65 KDa and amniochorion proenzyme and active enzyme at 65 and 50 KDa, respectively(PMID: 28772283, PMID:15042023).

Publications

What published studies show

Anti-MMP-8 (Cat# 17874-1-AP) has 21 citations across journals including Nature Communications, Advanced Science, Journal of Controlled Release, JCI Insight, Stem Cell Research & Therapy, PLoS Pathogens, BMC Cancer, and Viruses. Research fields span diabetic wound healing, myocardial fibrosis, pulmonary hypertension, colorectal cancer, rheumatoid arthritis, acute kidney injury, preeclampsia, osteoarthritis, corneal injury, and infectious disease pathology.

Automatically generated from the 21 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Adv Sci (Weinh); Flexible Organic Photovoltaic-Powered Hydrogel Bioelectronic Dressing With Biomimetic Electrical Stimulation for Healing Infected Diabetic Wounds; Authors - Yi-Wei Hu
human	WB,IF	J Control Release; Exosomal miRNA-26b-5p from PRP suppresses NETs by targeting MMP-8 to promote diabetic wound healing; Authors - Shunli Rui
human	IF	J Transl Med; Pretreatment of UC-MSCs with IFN-α2 improves treatment of liver fibrosis by recruiting neutrophils; Authors - Ye Xie
mouse	IHC	Int J Biol Macromol; Integration of single-cell RNA sequencing and spatial transcriptomics reveals neutrophil diversity and spatial heterogeneity in acute kidney injury.; Authors - Xintong Liu
mouse,human	WB,IHC	Stem Cell Res Ther; Transplantation of human amniotic epithelial cells promotes morphological and functional regeneration in a rat uterine scar model.; Authors - Yihui Fan
mouse	IF	Front Immunol; CCR1(+) monocytes facilitating bronchopulmonary dysplasia through regulation of S100A8 and MMP8.; Authors - Yingjuan Geng