Rat MMP8 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85211-4-RR (same clone as 85211-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85211-4-RR (MMP-8 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85211-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 85211-4-RR (same clone as 85211-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 85211-4-RR (MMP8 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85211-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 85211-4-RR (same clone as 85211-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 85211-4-RR (MMP8 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85211-4-PBS in a different storage buffer formulation.

MMP8 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 85211-4-PBS

Clone No.242473H8

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

WB, IHC, Indirect ELISA

Synonyms

EC:3.4.24.34, Matrix metalloproteinase-8, MMP-8, Neutrophil collagenase

---

Product Information

85211-4-PBS targets MMP8 in WB, IHC, Indirect ELISA applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3278

  Product name: Recombinant Rat MMP-8 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 21-466 aa of NM_022221.1

  Sequence: LPVPPEHLEEKNMKTAENYLRKFYHLPSNQFRSARNATMIAEKLKEMQRFFGLPETGKPDAATIEIMEKPRCGVPDSGDFLLTPGSPKWTHTNLTYRIINHTPQMSKAEVKTEIEKAFKIWSVPSTLTFTETLEGEADINIAFVSRDHGDNSPFDGPNGILAHAFQPGRGIGGDAHFDSEETWTQDSKNYNLFLVAAHEFGHSLGLSHSTDPGALMYPNYAYREPSTYSLPQDDINGIQTIYGPSDNPVQPTGPSTPTACDPHLRFDAATTLRGEIYFFKDKYFWRRHPQLRTVDLNFISLFWPFLPNGLQAAYEDFDRDLVFLFKGRQYWALSAYDLQQGYPRDISNYGFPRSVQAIDAAVSYNGKTYFFVNNQCWRYDNQRRSMDPGYPTSIASVFPGINCRIDAVFQQDSFFLFFSGPQYFAFNLVSRRVTRVARSNLWLNCP

• Full Name: matrix metallopeptidase 8
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: NM_022221.1
• Gene Symbol: Mmp8
• Gene ID (NCBI): 63849
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O88766
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MMP8(Matrix metalloproteinase-8) an enzyme that degrades fibrillar collagens imparting strength to the fetal membranes, is expressed by leukocytes and chorionic cytotrophoblast cells(PMID:15367487). Purified human neutrophil MMP-8 with proeMMP-8 at 70-75 KDa and active enzyme at 65 KDa and amniochorion proenzyme and active enzyme at 65 and 50 KDa, respectively(PMID: 28772283, PMID:15042023).