Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

MMS19 Monoclonal antibody

MMS19 Monoclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 66049-1-Ig
Clone No. 2H6D8
Publications (6)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

hMMS19, MET18, MET18 homolog, MMS19, MMS19 like protein, MMS19L

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for MMS19 in ?

Tested Applications

Positive WB detected inHeLa cells, fetal human brain tissue, HEK-293 cells, HepG2 cells, human brain tissue, human kidney tissue, NIH/3T3 cells, rat brain tissue, RAW 264.7 cells
Positive IP detected inmouse brain tissue
Positive IHC detected inmouse testis tissue, human cervical cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHela cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66049-1-Ig targets MMS19 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8960

Product name: Recombinant human MMS19 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 457-803 aa of BC006575

Sequence: FLDGNVSFLPENSFPSRFQPFQDGSSGQRRLIALLMAFVCSLPRNVEIPQLNQLMRELLELSCCHSCPFSSTAAAKCFAGLLNKHPAGQQLDEFLQLAVDKVEAGLDSGPCRSQAFTLLLWVTKALVLRYHPLSSCLTARLMGLLSDPELGPAAADGFSLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVQGFHAAPQDVKPNYLKGLSHVLNRLPKPVLLPELPTLLSLLLEALSCPDCVVQLSTLSCLQPLLLEAPQVMSLHVDTLVTKFLNLSSSPSMAVRIAALQCMHALTRLPTPVLLPYKPQVIRALAKPLDDKKRLVRKEAVSARGEWFLLGSPGS

Predict reactive species
Full Name MMS19 nucleotide excision repair homolog (S. cerevisiae)
Calculated Molecular Weight 1030 aa, 113 kDa
Observed Molecular Weight 103 kDa, 38 kDa
GenBank Accession NumberBC006575
Gene Symbol MMS19
Gene ID (NCBI) 64210
RRIDAB_11041708
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96T76
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MMS19 (MMS19 nucleotide excision repair homolog), also known as MET18, is a 1,030 amino acid nuclear protein containing seven HEAT repeats that belongs to the MET18/MMS19 family. Via its interactions with TFIIH p80 and TFIIH p89 helicases, MMS19 plays a role in nucleotide excision repair (NER) and RNA polymerase II (Pol II) transcription. MMS19 may also function as a transcriptional coactivator of estrogen receptor. While ubiquitously expressed, highest levels of MMS19 have been found in testis. At least five distinct MMS19 protein isoforms exist, which are produced by alternative splicing events.

Protocols

Product Specific Protocols
IF protocol for MMS19 antibody 66049-1-IgDownload protocol
IHC protocol for MMS19 antibody 66049-1-IgDownload protocol
IP protocol for MMS19 antibody 66049-1-IgDownload protocol
WB protocol for MMS19 antibody 66049-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-MMS19 antibody (Cat# 66049-1-Ig) has 6 total citations. Citations appear in Science, Molecular Cell, Advanced Science, Journal of Biological Chemistry, Cancer Biomarkers, and Aging. Research fields include iron-sulfur cluster biogenesis, iron homeostasis, ferritinophagy and lipid metabolism, DNA metabolism and genomic integrity, and cancer biology (non-small cell lung cancer and colon cancer). All cited applications are Western blot, with one study also using IHC and IF.

SpeciesApplicationTitle
humanWB

Science

MMS19 assembles iron-sulfur proteins required for DNA metabolism and genomic integrity.

Authors - Oliver Stehling
  • KD Validated
humanWB

Mol Cell

An Oxygen-Dependent Interaction between FBXL5 and the CIA-Targeting Complex Regulates Iron Homeostasis.

Authors - Adarsh K Mayank
pigWB

Adv Sci (Weinh)

Ferritinophagy Rewires Carnitine-Dependent Lipid Metabolism to Inhibit PRRSV and IAV Replication.

Authors - Kaifeng Guan
HumanWB

J Biol Chem

Iron-Regulated Assembly of the Cytosolic Iron-Sulfur Cluster Biogenesis Machinery.

Authors - Xiaorui Fan
humanWB

Cancer Biomark

MMS19 as a potential predictive marker of adjuvant chemotherapy benefit in resected non-small cell lung cancer.

Authors - Julien Adam
  • KD Validated
humanWB,IHC,IF

Aging (Albany NY)

Exploring Cancer Dependency Map genes and immune subtypes in colon cancer, in which TIGD1 contributes to colon cancer progression

Authors - Guoyang Zhang
Loading...
||
New chat

Able™

正在加载,请稍候...