MMS2 Recombinant monoclonal antibody

• 

  WB analysis using 86551-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86551-3-RR (MMS2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 86551-3-RR

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 86551-3-RR (MMS2 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 86551-3-RR

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 86551-3-RR (MMS2 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

MMS2 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 86551-3-RR

Clone No.251485F12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

UBE2V2, DDVit 1, DDVIT1, EDAF 1, EDAF-1

---

Tested Applications

• Positive WB detected in: A375 cells, HeLa cells, HEK-293 cells, mouse liver tissue, rat liver tissue, mouse kidney tissue, rat kidney tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86551-3-RR targets MMS2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1111

  Product name: Recombinant human UBE2V2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-145 aa of BC007051

  Sequence: MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN

• Full Name: ubiquitin-conjugating enzyme E2 variant 2
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 16-18 kDa
• GenBank Accession Number: BC007051
• Gene Symbol: MMS2
• Gene ID (NCBI): 7336
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15819
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MMS2 encodes a 137-amino acid, 15.2-kDa protein with significant sequence homology to a conserved family of ubiquitin-conjugating (Ubc) proteins (PMID: 9576943). Mms2 is a ubiquitin E2-variant protein with a very well-documented function in the tolerance pathway that protects both human and yeast cells from the lethal and mutagenic effects of DNA damage (PMID: 36934633). A high expression level of human MMS2 is associated with poor survival prognosis in different cancer diseases (PMID: 36934633).