MNK1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MNK1 Polyclonal antibody, PBS Only (10136-1-PBS)

• 

  WB analysis of HeLa using 10136-1-AP (same clone as 10136-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 10136-1-AP (MNK1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10136-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 10136-1-AP (same clone as 10136-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 10136-1-AP (MNK1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10136-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 10136-1-AP (same clone as 10136-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10136-1-AP (MNK1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10136-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 10136-1-AP (same clone as 10136-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10136-1-AP (MNK1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10136-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse small intestine using 10136-1-AP (same clone as 10136-1-PBS)

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 10136-1-AP (MNK1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10136-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 10136-1-AP (same clone as 10136-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 10136-1-AP (MNK1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10136-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 10136-1-AP (same clone as 10136-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 10136-1-AP (MNK1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10136-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 10136-1-AP (same clone as 10136-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using MNK1 antibody (10136-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10136-1-PBS in a different storage buffer formulation.

MNK1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 10136-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

MKNK1, EC:2.7.11.1, MAP kinase signal-integrating kinase 1, MAP kinase-interacting serine/threonine-protein kinase 1, MAPK signal-integrating kinase 1

---

Product Information

10136-1-PBS targets MNK1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0184

  Product name: Recombinant human MKNK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 299-465 aa of BC002755

  Sequence: PPFVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDLISKLLVRDAKQRLSAAQVLQHPWVQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENELAEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL

• Full Name: MAP kinase interacting serine/threonine kinase 1
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 51 kDa, 47 kDa
• GenBank Accession Number: BC002755
• Gene Symbol: MNK1
• Gene ID (NCBI): 8569
• RRID: AB_2250527
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BUB5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MNK1 (mitogen-activated protein kinase-interacting kinase 1) was discovered as a consequence of bacterial expression libraries screening for proteins regulated by the classical mitogen-activated protein kinases, the ERKs (extracellular signal-regulated kinases). Phosphorylation of Mnk1 has been shown to activate its kinase activity as well as to enhance its binding to the eukaryotic initiation factor 4G (eIF4G) which functions as a scaffolding protein. Human MNK1 arises from an alternatively spliced transcript giving rise to 2 isoforms, longer MNK1a (50 kDa) and a shorter MNK1b variant (38 kDa) that lacks 89 C-terminal amino acids(PMID: 21406405).