MOBKL2A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MOBKL2A Polyclonal antibody (16942-1-AP)

MOBKL2A Polyclonal Antibody for WB, ELISA

Cat No. 16942-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

MOB kinase activator 3A, MOB LAK, Mob1 homolog 2A, MOB3A, moblak

• 

  WB analysis of Raji using 16942-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 16942-1-AP (MOBKL2A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse thymus using 16942-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 16942-1-AP (MOBKL2A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 16942-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16942-1-AP (MOBKL2A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lymph using 16942-1-AP

  mouse lymph tissue were subjected to SDS PAGE followed by western blot with 16942-1-AP (MOBKL2A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MOBKL2A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Raji cells, Jurkat cells, mouse lymph tissue, mouse thymus tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16942-1-AP targets MOBKL2A in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10540

  Product name: Recombinant human MOBKL2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-217 aa of BC015049

  Sequence: MSNPFLKQVFNKDKTFRPKRKFEPGTQRFELHKKAQASLNAGLDLRLAVQLPPGEDLNDWVAVHVVDFFNRVNLIYGTISDGCTEQSCPVMSGGPKYEYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNEDLFPTNVGTPFPKNFLQTVRKILSRLFRVFVHVYIHHFDRIAQMGSEAHVNTCYKHFYYFVKEFGLIDTKELEPLKEMTARMCH

• Full Name: MOB1, Mps One Binder kinase activator-like 2A (yeast)
• Calculated Molecular Weight: 217 aa, 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC015049
• Gene Symbol: MOBKL2A
• Gene ID (NCBI): 126308
• RRID: AB_2145383
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96BX8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MOBKL2A Polyclonal antibody (Cat# 16942-1-AP) has 1 citation. It was cited in Journal of Cellular and Molecular Medicine (IF 4.7), in a 2022 study by Zhi-Hang Huang et al. titled "Identification of core genes in prefrontal cortex and hippocampus of Alzheimer's disease based on mRNA-miRNA network." The research field is Alzheimer's disease/neuroscience, with the antibody applied in Western Blot using mouse samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Cell Mol Med; Identification of core genes in prefrontal cortex and hippocampus of Alzheimer's disease based on mRNA-miRNA network; Authors - Zhi-Hang Huang