MOCS2B Polyclonal antibody

• 

  WB analysis using 14416-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14416-1-AP (MOCS2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14416-1-AP

  WB result of MOCS2B antibody (14416-1-AP; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-MOCS2B transfected HeLa cells.

• 

  WB analysis of mouse heart using 14416-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 14416-1-AP (MOCS2 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14416-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14416-1-AP (MOCS2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 14416-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14416-1-AP (MOCS2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat heart using 14416-1-AP

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 14416-1-AP (MOCS2B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat heart using 14416-1-AP

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 14416-1-AP (MOCS2B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 14416-1-AP

  Immunofluorescent analysis of HeLa cells using 14416-1-AP (MOCS2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

MOCS2B Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 14416-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

MOCS2, MCBPE, MOCO1, MOCO1 A, MOCO1-A

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, mouse heart tissue
• Positive IHC detected in: rat heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14416-1-AP targets MOCS2B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5761

  Product name: Recombinant human MOCS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-188 aa of BC046097

  Sequence: MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNS

• Full Name: molybdenum cofactor synthesis 2
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC046097
• Gene Symbol: MOCS2
• Gene ID (NCBI): 4338
• RRID: AB_2250779
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O96007
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MOCS2(Molybdenum cofactor synthesis 2) is a heterotetrameric synthase comprised of 2 small (MOCS2A) and 2 large (MOCS2B) subunits. MOCS2 acts as a sulfur carrier required for molybdopterin biosynthesis. The two MOCS2 proteins A and B are subunits of molybdopterin synthase incorporating sulfur groups delivered by the MOCS3 sulfurylase.