MOG Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP00110-4

  Sandwich ELISA standard curve of MP00110-4, Human MOG Recombinant Matched Antibody Pair - PBS only. 83063-8-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg2878. 83063-7-PBS was HRP conjugated as the detection antibody. Range: 78.1-5000 pg/mL.

• 

  Sample test of MP00110-4

  The mean MOG concentration was determined to be 158.5 ng/mL in mouse brain extract based on a 6.6 mg/mL extract load.

MOG Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83063-8-PBS

Clone No.250235D11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

MOGIG 2, Myelin-oligodendrocyte glycoprotein

---

Product Information

83063-8-PBS targets MOG as part of a matched antibody pair:

MP00110-4: 83063-8-PBS capture and 83063-7-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2878

  Product name: Recombinant Human MOG protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 30-154 aa of N/A

  Sequence: GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG

• Full Name: myelin oligodendrocyte glycoprotein
• Calculated Molecular Weight: 24 kDa
• GenBank Accession Number: N/A
• Gene Symbol: MOG
• Gene ID (NCBI): 4340
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16653-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.