Product Information
30673-1-PBS targets MORF4L1 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33839 Product name: Recombinant human MORF4L1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC022845 Sequence: MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKK Predict reactive species |
| Full Name | mortality factor 4 like 1 |
| Calculated Molecular Weight | 362 aa, 41 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | BC022845 |
| Gene Symbol | MORF4L1 |
| Gene ID (NCBI) | 10933 |
| RRID | AB_3086384 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UBU8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
MORF4L1, also named as MRG15, belongs to the MRG family. It is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. It is also component of the mSin3A complex which acts to repress transcription by deacetylation of nucleosomal histones. (PMID:14966270) This antibody has no cross-reaction to MORF4L2.

