MORF4L2 Polyclonal antibody

• 

  WB analysis of HeLa using 14710-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14710-1-AP (MORF4L2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14710-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14710-1-AP (MORF4L2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 14710-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 14710-1-AP (MORF4L2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 14710-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 14710-1-AP (MORF4L2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IF Staining of MCF-7 using 14710-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using MORF4L2 antibody (14710-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of HeLa using 14710-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 14710-1-AP (MORF4L2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

MORF4L2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 14710-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Mortality factor 4-like protein 2, mortality factor 4 like 2, MORF-related gene X protein, MORFL2, MORF related gene X protein

---

Tested Applications

• Positive WB detected in: HeLa cells, human liver tissue, mouse liver tissue, A431 cells, A549 cells, MCF-7 cells
• Positive IF/ICC detected in: MCF-7 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

14710-1-AP targets MORF4L2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6404

  Product name: Recombinant human MORF4L2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-288 aa of BC056899

  Sequence: MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL

• Full Name: mortality factor 4 like 2
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 30-32 kDa
• GenBank Accession Number: BC056899
• Gene Symbol: MORF4L2
• Gene ID (NCBI): 9643
• RRID: AB_2297880
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15014
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Front Immunol; Risk stratification based on DNA damage-repair-related signature reflects the microenvironmental feature, metabolic status and therapeutic response of breast cancer; Authors - Chunzhen Li