MORG1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MORG1 Polyclonal antibody (27244-1-AP)

• Featured Product
• KD/KO Validated

MORG1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27244-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

MAPK organizer 1, Mitogen-activated protein kinase organizer 1, WD repeat domain-containing protein 83, WDR83

• 

  WB analysis of mouse testis using 27244-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 27244-1-AP (MORG1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 27244-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27244-1-AP (MORG1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 27244-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27244-1-AP (MORG1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 27244-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27244-1-AP (MORG1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 27244-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using MORG1 antibody (27244-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse testis tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27244-1-AP targets MORG1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15141

  Product name: Recombinant human MORG1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-315 aa of BC005870

  Sequence: MAFPEPKPRPPELPQKRLKTLDCGQGAVRAVRFNVDGNYCLTCGSDKTLKLWNPLRGTLLRTYSGHGYEVLDAAGSFDNSSLCSGGGDKAVVLWDVASGQVVRKFRGHAGKVNTVQFNEEATVILSGSIDSSIRCWDCRSRRPEPVQTLDEARDGVSSVKVSDHEILAGSVDGRVRRYDLRMGQLFSDYVGSPITCTCFSRDGQCTLVSSLDSTLRLLDKDTGELLGEYKGHKNQEYKLDCCLSERDTHVVSCSEDGKVFFWDLVEGALALALPVGSGVVQSLAYHPTEPCLLTAMGGSVQCWREEAYEAEDGAG

• Full Name: mitogen-activated protein kinase organizer 1
• Calculated Molecular Weight: 315 aa, 34 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC005870
• Gene Symbol: MORG1
• Gene ID (NCBI): 84292
• RRID: AB_2880816
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRX9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Int Immunopharmacol; Methylene blue targets PHD3 expression in murine microglia to mitigate lipopolysaccharide-induced neuroinflammation and neurocognitive impairments; Authors - Guoyao Ou ; KD Validated
human	WB,CoIP	PLoS Pathog; Splicing-dependent restriction of the HBZ gene by Tax underlies biphasic HTLV-1 infection; Authors - Yi Liang