MORG1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MORG1 Polyclonal antibody (27244-1-AP)

• Featured Product
• KD/KO Validated

MORG1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27244-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

MAPK organizer 1, Mitogen-activated protein kinase organizer 1, WD repeat domain-containing protein 83, WDR83

• 

  WB analysis of mouse testis using 27244-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 27244-1-AP (MORG1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 27244-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27244-1-AP (MORG1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 27244-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27244-1-AP (MORG1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 27244-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27244-1-AP (MORG1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 27244-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using MORG1 antibody (27244-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MORG1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse testis tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27244-1-AP targets MORG1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15141

  Product name: Recombinant human MORG1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-315 aa of BC005870

  Sequence: MAFPEPKPRPPELPQKRLKTLDCGQGAVRAVRFNVDGNYCLTCGSDKTLKLWNPLRGTLLRTYSGHGYEVLDAAGSFDNSSLCSGGGDKAVVLWDVASGQVVRKFRGHAGKVNTVQFNEEATVILSGSIDSSIRCWDCRSRRPEPVQTLDEARDGVSSVKVSDHEILAGSVDGRVRRYDLRMGQLFSDYVGSPITCTCFSRDGQCTLVSSLDSTLRLLDKDTGELLGEYKGHKNQEYKLDCCLSERDTHVVSCSEDGKVFFWDLVEGALALALPVGSGVVQSLAYHPTEPCLLTAMGGSVQCWREEAYEAEDGAG

• Full Name: mitogen-activated protein kinase organizer 1
• Calculated Molecular Weight: 315 aa, 34 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC005870
• Gene Symbol: MORG1
• Gene ID (NCBI): 84292
• RRID: AB_2880816
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRX9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MORG1 polyclonal antibody (Cat# 27244-1-AP) has 2 citations. One appeared in International Immunopharmacology (2023), studying methylene blue's effect on PHD3 expression in murine microglia related to neuroinflammation and neurocognitive impairment. The other was published in PLoS Pathogens (2025), investigating splicing-dependent restriction of the HBZ gene by Tax in HTLV-1 infection. The research fields span neuroimmunology and virology.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Int Immunopharmacol; Methylene blue targets PHD3 expression in murine microglia to mitigate lipopolysaccharide-induced neuroinflammation and neurocognitive impairments; Authors - Guoyao Ou ; KD Validated
human	WB,CoIP	PLoS Pathog; Splicing-dependent restriction of the HBZ gene by Tax underlies biphasic HTLV-1 infection; Authors - Yi Liang