MORN2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MORN2 Polyclonal antibody, PBS Only (21224-1-PBS)

• 

  IHC staining of mouse testis using 21224-1-AP (same clone as 21224-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 21224-1-AP (MORN2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21224-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 21224-1-AP (same clone as 21224-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 21224-1-AP (MORN2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21224-1-PBS in a different storage buffer formulation.

MORN2 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 21224-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

21224-1-PBS targets MORN2 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15665

  Product name: Recombinant human MORN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-79 aa of BC102035

  Sequence: MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLEWSGNFHFTAAPDLKLKLHM

• Full Name: MORN repeat containing 2
• Calculated Molecular Weight: 79 aa, 9 kDa
• GenBank Accession Number: BC102035
• Gene Symbol: MORN2
• Gene ID (NCBI): 729967
• RRID: AB_3669362
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q502X0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

(MORN2 is a testis-enriched protein and its initial expression coincides with the first wave of meiosis. MORN2 functions in the dynamic regulation of acrosome biogenesis during late spermiogenesis, and MORN2 has been shown to function in LC3-associated phagocytosis and in resistance to bacterial infection in planarians.