MORN5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MORN5 Polyclonal antibody, PBS Only (24978-1-PBS)

• 

  WB analysis using 24978-1-AP (same clone as 24978-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24978-1-AP (MORN5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24978-1-PBS in a different storage buffer formulation.

MORN5 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24978-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

24978-1-PBS targets MORN5 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21691

  Product name: Recombinant human MORN5 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-161 aa of BC133690

  Sequence: MEYTGSKYIGEYVDGRMEGKAKYILPTETIYVGEMKDGMFHGEGTLYFPSGSQYDAIWENGLAIKGTYTFSDGLHYDEKNWHYCDGYDRRFYTEILNGLKPAGMAQLTNMDPPRKIPKGYYDCGDGFYNPVTRVVKDYRNRFLRNADDDEHEWITRTCRKG

• Full Name: MORN repeat containing 5
• Calculated Molecular Weight: 161 aa, 19 kDa
• Observed Molecular Weight: 15-20 kDa
• GenBank Accession Number: BC133690
• Gene Symbol: MORN5
• Gene ID (NCBI): 254956
• RRID: AB_3085765
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VZ52
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MORN5 is germ cell-specific and indeed expressed exclusively in the testis, and was developmentally regulated during spermatogenesis(PMID: 28742876). MORN5 is expressed in mouse spermatocytes and is present in all stages of germ cells during sperm development.