Tested Applications
| Positive WB detected in | HepG2 cells, human placenta tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25490-1-AP targets MOSC1 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21989 Product name: Recombinant human MOSC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 117-230 aa of BC010619 Sequence: LTCDGDTLTLSAAYTKDLLLPIKTPTTNAVHKCRVHGLEIEGRDCGEAAAQWITSFLKSQPYRLVHFEPHKRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEK Predict reactive species |
| Full Name | MOCO sulphurase C-terminal domain containing 1 |
| Calculated Molecular Weight | 337 aa, 37 kDa |
| Observed Molecular Weight | 35-42 kDa |
| GenBank Accession Number | BC010619 |
| Gene Symbol | MOSC1 |
| Gene ID (NCBI) | 64757 |
| RRID | AB_3669480 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q5VT66 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MOSC1 also known as MTARC1 and MARC1. It has 3 isoforms and is mainly expressed in liver, breast and adipose tissue. It is a novel signal-anchored protein of the outer mitochondrial membrane and is active in the N- reductive enzyme system and was also found to contribute to the regulation of nitric oxide synthesis (PMID: 23086957).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for MOSC1 antibody 25490-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

