MOSC2 Polyclonal antibody

MOSC2 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 24782-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

MOSC domain-containing protein 2, Molybdenum cofactor sulfurase C-terminal domain-containing protein 2, Moco sulfurase C-terminal domain-containing protein 2, Mitochondrial amidoxime reducing component 2, mARC2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue, mouse liver tissue, rat liver tissue, rat kidney tissue
Positive IHC detected inhuman liver cancer tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:100-1:400
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

24782-1-AP targets MOSC2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20694

Product name: Recombinant human MOSC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 118-229 aa of BC011973

Sequence: YENNCLIFRAPDMDQLVLPSKQPSSNKLHNCRIFGLDIKGRDCGNEAAKWFTNFLKTEAYRLVQFETNMKGRTSRKLLPTLDQNFQVAYPDYCPLLIMTDASLVDLNTRMEK

Predict reactive species
Full Name MOCO sulphurase C-terminal domain containing 2
Calculated Molecular Weight 335 aa, 38 kDa
Observed Molecular Weight 35-38 kDa
GenBank Accession NumberBC011973
Gene Symbol MOSC2
Gene ID (NCBI) 54996
RRIDAB_2879719
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ969Z3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MOSC domain-containing protein 2 (also known as MOSC2), also known as MARC2, is a component of prodrug-converting system, reduces a multitude of N-hydroxylated prodrugs particularly amidoximes, leading to increased drug bioavailability. Also, MOSC2 may be involved in mitochondrial N(omega)-hydroxy-L-arginine (NOHA) reduction, regulating endogenou1s nitric oxide levels and biosynthesis. The reductase activity is regulated under adipogenic conditions, and down-regulation of the terminal component MOSC2 resulted in decreased lipid synthesis, suggesting a possible physiological role of this enzyme system and its component MOSC2 in lipogenesis(PMID: 22203676).

Protocols

Product Specific Protocols
WB protocol for MOSC2 antibody 24782-1-APDownload protocol
IHC protocol for MOSC2 antibody 24782-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cancers (Basel)

RNA Sequencing of Collecting Duct Renal Cell Carcinoma Suggests an Interaction between miRNA and Target Genes and a Predominance of Deregulated Solute Carrier Genes.

Authors - Sven Wach

PLoS Genet

Divergent role of Mitochondrial Amidoxime Reducing Component 1 (MARC1) in human and mouse

Authors - Eriks Smagris
Loading...
||
New chat Able
正在加载,请稍候...