MOXD1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MOXD1 Polyclonal antibody (29913-1-AP)

• 

  WB analysis using 29913-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29913-1-AP (MOXD1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

MOXD1 Polyclonal Antibody for WB, ELISA

Cat No. 29913-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

DBH-like monooxygenase protein 1, EC:1.14.17.-, Monooxygenase X, monooxygenase, DBH like 1, MOX

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29913-1-AP targets MOXD1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30215

  Product name: Recombinant human MOXD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 510-613 aa of BC018756

  Sequence: KSPKQYKNLSFMDAMNKFKWTKKEGLSFNELVLSLPVNVRCSKTDNAEWSIQGMTALPPDIERPYKAEPLVCGTSSSSSLHRDFSINLLVCLLLLSCTLSTKSL

• Full Name: monooxygenase, DBH-like 1
• Calculated Molecular Weight: 69 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC018756
• Gene Symbol: MOXD1
• Gene ID (NCBI): 26002
• RRID: AB_3742320
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UVY6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Monooxygenase DBH like 1 (MOXD1) is a member of the copper monooxygenase family, including dopamine monooxygenase (dopamine β-monooxygenase, DBM) and peptidylglycine α-hydroxylating monooxygenase (PHM). MOXD1 is expressed during the development of the neural crest, and distributed along the olfactory bulb, cerebellum, brain stem, and parietal cortex with the development of nerve cells, participating in the basal plate. MOXD1 is highly expressed in GBM cells and can promote the growth of cancer cells (PMID: 35393406). In addition, MOXD1 is a gate-keeper of organ homeostasis and functions as a tumor-suppressor in neuroblastoma.