MPDU1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MPDU1 Polyclonal antibody, PBS Only (20321-1-PBS)

• 

  WB analysis using 20321-1-AP (same clone as 20321-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20321-1-AP (MPDU1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20321-1-PBS in a different storage buffer formulation.

MPDU1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20321-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

CDGIF, HBEBP2BPA, Lec35, Mannose-P-dolichol utilization defect 1 protein, My008

---

Product Information

20321-1-PBS targets MPDU1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14178

  Product name: Recombinant human MPDU1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-84 aa of BC001898

  Sequence: MAAEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSKGLGLGIVAGSLLVKLPQVFKILGAKSAEGLSLQSVMLELV

• Full Name: mannose-P-dolichol utilization defect 1
• Calculated Molecular Weight: 247 aa, 27 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC001898
• Gene Symbol: MPDU1
• Gene ID (NCBI): 9526
• RRID: AB_3741987
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75352
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.