MPP10 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MPP10 Polyclonal antibody (32275-1-AP)

• 

  WB analysis using 32275-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32275-1-AP (MPHOSPH10 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A431 using 32275-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using MPP10 antibody (32275-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

MPP10 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 32275-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

MPHOSPH10

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32275-1-AP targets MPP10 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37602

  Product name: Recombinant human MPHOSPH10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 391-654 aa of BC126389

  Sequence: TAQKRPENSLLEETLHFDHAVRMAPVITEETTLQLEDIIKQRIRDQAWDDVVRKEKPKEDAYEYKKRLTLDHEKSKLSLAEIYEQEYIKLNQQKTAEEENPEHVEIQKMMDSLFLKLDALSNFHFIPKPPVPEIKVVSNLPAITMEEVAPVSVSDAALLAPEEIKEKNKAGDIKTAAEKTATDKKRERRKKKYQKRMKIKEKEKRRKLLEKSSVDQAGKYSKTVASEKLKQLTKTGKASFIKDEGKDKALKSSQAFFSKLQDQV

• Full Name: M-phase phosphoprotein 10 (U3 small nucleolar ribonucleoprotein)
• Calculated Molecular Weight: 681 aa, 79 kDa
• Observed Molecular Weight: 105 kDa
• GenBank Accession Number: BC126389
• Gene Symbol: MPHOSPH10
• Gene ID (NCBI): 10199
• RRID: AB_3742563
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O00566
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MPP10, also known as M phase phosphoprotein 10, is a component of the U3 small nucleolar ribonucleoprotein (U3 snoRNP) complex. The protein localizes to the nucleolus during interphase and to the chromosomes during M phase. It plays a crucial role in the early cleavages during pre-18S ribosomal RNA processing.