MRE11A Monoclonal antibody

• 

  WB analysis using 67570-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67570-1-Ig (MRE11A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

MRE11A Monoclonal Antibody for WB, ELISA

Cat No. 67570-1-Ig

Clone No.1B12B2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

MRE11, 1B12B2, ATLD, Double-strand break repair protein MRE11, EC:3.1.-.-

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, 4T1 cells

Recommended dilution

• Western Blot (WB): WB : 1:3000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67570-1-Ig targets MRE11A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28847

  Product name: Recombinant human MRE11A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 170-400 aa of BC063458

  Sequence: QKGSTKIALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGSTNFIPEQFLDDFIDLVIWGHEHECKIAPTKNEQQLFYISQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMHKIPLHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERERLGNSHQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFR

• Full Name: MRE11 meiotic recombination 11 homolog A (S. cerevisiae)
• Observed Molecular Weight: 81 kDa
• GenBank Accession Number: BC063458
• Gene Symbol: MRE11A
• Gene ID (NCBI): 4361
• RRID: AB_2882784
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P49959
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mre11 (meiotic recombination 11), also named as Mre11A, is a component of the MRN( MRE11/RAD50/NBS1) complex which is a versatile complex, playing a key role in the sensing, processing, and repair of DSBs. MRE11 possesses both endonuclease and 3'-5' exonuclease activity. It contains two DNA-binding domains (DBDs), enabling it to bind both single-stranded DNA (ssDNA) and double-stranded DNA (dsDNA). After DSBs, MRE11 is loaded onto DSBs sites and cleaves DNA by cooperating with CtIP (CtBP [C terminal binding protein] interacting protein) to initiate end resection. It's reported that MRE11 is over-expressed in breast cancers. (PMID:38128537; 22914783)