MRGPRE Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MRGPRE Polyclonal antibody, PBS Only (28080-1-PBS)

• 

  IHC staining of rat dorsal root ganglion using 28080-1-AP (same clone as 28080-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat dorsal root ganglion tissue slide using 28080-1-AP (MRGPRE antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28080-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat dorsal root ganglion using 28080-1-AP (same clone as 28080-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat dorsal root ganglion tissue slide using 28080-1-AP (MRGPRE antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28080-1-PBS in a different storage buffer formulation.

MRGPRE Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 28080-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

28080-1-PBS targets MRGPRE in IHC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24913

  Product name: Recombinant human MRGPRE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 262-311 aa of BC104889

  Sequence: AAKPVVYFCLGSAQGRRLPLRLVLQRALGDEAELGAVRETSRRGLVDIAA

• Full Name: MAS-related GPR, member E
• Calculated Molecular Weight: 311 aa, 34 kDa
• GenBank Accession Number: BC104889
• Gene Symbol: MRGPRE
• Gene ID (NCBI): 116534
• RRID: AB_3669642
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86SM8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MRGPRE (Mas-related G-protein coupled receptor member E, also named GPR167 ) may regulate nociceptor function or development, including the sensation or modulation of pain.