Product Information
27825-1-PBS targets MRP1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27048 Product name: Recombinant human ABCC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 918-1025 aa of NM_004996 Sequence: SSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGALGIS Predict reactive species |
| Full Name | ATP-binding cassette, sub-family C (CFTR/MRP), member 1 |
| Calculated Molecular Weight | 172 kDa |
| Observed Molecular Weight | 180-190 kDa |
| GenBank Accession Number | NM_004996 |
| Gene Symbol | MRP1 |
| Gene ID (NCBI) | 4363 |
| RRID | AB_3085997 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P33527 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Multidrug resistant-associated protein 1 (MRP1, also known as ABCC1) is a member of the ATP-binding cassette (ABC) transporter protein superfamily, subfamily C. MRP1 is overexpressed in cancers and contributes to the occurrence of multidrug resistance (MDR). Expression of MRP1 has been considered as a negative marker for the outcome of chemotherapy. Recently MRP1 has been reported to play a crucial role in Aβ clearance at the blood-brain barrier.





