MRP2 Polyclonal antibody

MRP2 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 24893-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, ELISA

ABCC2, ABCC 2, ATP-binding cassette sub-family C member 2, CMOAT, CMOAT1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells
Positive IHC detected inhuman small intestine tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24893-1-AP targets MRP2 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, rat, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18694

Product name: Recombinant human ABCC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 193-325 aa of BC136419

Sequence: NPSSIASFLSSITYSWYDSIILKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSGTKKDVPKSWLMKALFKTFYMVLLKS

Predict reactive species
Full Name ATP-binding cassette, sub-family C (CFTR/MRP), member 2
Calculated Molecular Weight 1545 aa, 174 kDa
Observed Molecular Weight 190-250 kDa
GenBank Accession NumberBC136419
Gene Symbol ABCC2
Gene ID (NCBI) 1244
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ92887
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Multi-drug resistance protein 2 (MRP2), also known as ABCC2, is an ATP binding cassette (ABC) transporter responsible for biliary excretion of xenobiotics, endobiotics, and their metabolites. Deficiency in ABCC2 results in the clinical disorder Dubin-Johnson syndrome. MRP2 is found to be expressed in a variety of human cancers, and is associated with resistance of tumor cells to various anticancer drugs including cisplatin. The predicted molecular weight of MRP2 is 174 kDa, while mature MRP2 usually has a slower migration around 190-250 kDa due to the glycosylation. (16434545, 18834541, 23045960)

Protocols

Product Specific Protocols
IHC protocol for MRP2 antibody 24893-1-APDownload protocol
WB protocol for MRP2 antibody 24893-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

ACS Nano

Variability in the Clearance of Lead Oxide Nanoparticles Is Associated with Alteration of Specific Membrane Transporters.

Authors - Jana Dumková
WB

Theranostics

Circadian Clock Gene Bmal1 Regulates Bilirubin Detoxification: A Potential Mechanism of Feedback Control of Hyperbilirubinemia.

Authors - Shuai Wang
humanIHC

Theranostics

Generation of hepatic spheroids using human hepatocyte-derived liver progenitor-like cells for hepatotoxicity screening.

Authors - Zhenyu Wang
humanWB

Cell Death Dis

MUC1 induces acquired chemoresistance by upregulating ABCB1 in EGFR-dependent manner.

Authors - Wei Jin
humanWB

Oncol Res

The AKT/GSK3-Mediated Slug Expression Contributes to Oxaliplatin Resistance in Colorectal Cancer via Upregulation of ERCC1.

Authors - Wei Wei
humanWB

Sci Rep

Functional human induced hepatocytes (hiHeps) with bile acid synthesis and transport capacities: A novel in vitro cholestatic model.

Authors - Xuan Ni

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

SHENG-FU (Verified Customer) (01-15-2018)

there were multiple bands on the membrane, and the band under 130 kDa were a high expression. But around 190 kDa -250 kDa there are a single band which might be the correct one.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Rat primary astrocyte
MRP2 Antibody Western Blot, validation (1:500 dilution) in Rat primary astrocyte (Cat no:24893-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...