MRP2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MRP2 Polyclonal antibody, PBS Only (24893-1-PBS)

• 

  WB analysis of HepG2 using 24893-1-AP (same clone as 24893-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 24893-1-AP (MRP2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24893-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 24893-1-AP (same clone as 24893-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 24893-1-AP (MRP2 antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 24893-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 24893-1-AP (same clone as 24893-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 24893-1-AP (MRP2 antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 24893-1-PBS in a different storage buffer formulation.

MRP2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24893-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Synonyms

ABCC2, ABCC 2, ATP-binding cassette sub-family C member 2, CMOAT, CMOAT1

---

Product Information

24893-1-PBS targets MRP2 in applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18694

  Product name: Recombinant human ABCC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 193-325 aa of BC136419

  Sequence: NPSSIASFLSSITYSWYDSIILKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSGTKKDVPKSWLMKALFKTFYMVLLKS

• Full Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 2
• Calculated Molecular Weight: 1545 aa, 174 kDa
• Observed Molecular Weight: 190-250 kDa
• GenBank Accession Number: BC136419
• Gene Symbol: ABCC2
• Gene ID (NCBI): 1244
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92887
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Multi-drug resistance protein 2 (MRP2), also known as ABCC2, is an ATP binding cassette (ABC) transporter responsible for biliary excretion of xenobiotics, endobiotics, and their metabolites. Deficiency in ABCC2 results in the clinical disorder Dubin-Johnson syndrome. MRP2 is found to be expressed in a variety of human cancers, and is associated with resistance of tumor cells to various anticancer drugs including cisplatin. The predicted molecular weight of MRP2 is 174 kDa, while mature MRP2 usually has a slower migration around 190-250 kDa due to the glycosylation. (16434545, 18834541, 23045960)