MRPL20 Polyclonal antibody

• 

  WB analysis using 16969-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16969-1-AP (MRPL20 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 16969-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16969-1-AP (MRPL20 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

MRPL20 Polyclonal Antibody for WB, ELISA

Cat No. 16969-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

L20mt, Large ribosomal subunit protein bL20m, MRP L20, MRP-L20

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse heart tissue, HeLa cells, HepG2 cells, mouse liver tissue, rat heart tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

16969-1-AP targets MRPL20 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9160

  Product name: Recombinant human MRPL20 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-149 aa of BC009515

  Sequence: MVFLTAQLWLRNRVTDRYFRIQEVLKHARHFRGRKNRCYRLAVRTVIRAFVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH

• Full Name: mitochondrial ribosomal protein L20
• Calculated Molecular Weight: 149 aa, 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC009515
• Gene Symbol: MRPL20
• Gene ID (NCBI): 55052
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BYC9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Bone; Extracellular pH is a critical regulator of osteoclast fusion, size and activation; Authors - Bethan K Davies
human	WB	Nat Struct Mol Biol; A roadmap for ribosome assembly in human mitochondria; Authors - Elena Lavdovskaia