MRPL23 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MRPL23 Polyclonal antibody (11706-1-AP)

MRPL23 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11706-1-AP Copied!

Publications (9)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

MRP-L23, MRP L23, Large ribosomal subunit protein uL23m, L23mt, L23MRP

• 

  WB analysis of A2780 using 11706-1-AP

  A2780 cells were subjected to SDS PAGE followed by western blot with 11706-1-AP (MRPL23 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 11706-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 11706-1-AP (MRPL23 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 11706-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 11706-1-AP (MRPL23 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 11706-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 11706-1-AP (MRPL23 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 11706-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 11706-1-AP (MRPL23 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 11706-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 11706-1-AP (MRPL23 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 11706-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11706-1-AP (MRPL23 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A2780 using 11706-1-AP

  A2780 cells were subjected to SDS PAGE followed by western blot with 11706-1-AP (MRPL23 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 11706-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11706-1-AP (MRPL23 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 11706-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11706-1-AP (MRPL23 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of PC-3 using 11706-1-AP

  Immunofluorescent analysis of PC-3 cells using 11706-1-AP (MRPL23 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 11706-1-AP

  Immunofluorescent analysis of MCF-7 cells using 11706-1-AP (MRPL23 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MRPL23 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A2780 cells, HEK-293 cells, HeLa cells, MCF-7 cells, PC-3 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-3 cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11706-1-AP targets MRPL23 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2220

  Product name: Recombinant human MRPL23 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-153 aa of BC027710

  Sequence: MARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEGSAADDLYSMLEEERQQRQSSDPRRGGVPSWFGL

• Full Name: mitochondrial ribosomal protein L23
• Calculated Molecular Weight: 153 aa, 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC027710
• Gene Symbol: MRPL23
• Gene ID (NCBI): 6150
• RRID: AB_10694422
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16540
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The antibody anti-MRPL23 (Cat# 11706-1-AP) has a total of 9 citations across journals including Nature Communications, Nucleic Acids Research, Aging Cell, Genomics Proteomics Bioinformatics, Journal of Cell Biology, PLoS Genetics, Frontiers in Oncology, Human Molecular Genetics, and Discovery Oncology. Research fields span mitochondrial protein synthesis, mitoribosome biogenesis, mitochondrial dysfunction, cardiovascular disease, and cancer (non-small cell lung cancer and hepatocellular carcinoma).

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; Loss of the RNA-binding protein TACO1 causes late-onset mitochondrial dysfunction in mice.; Authors - Tara R Richman
human	WB	Nucleic Acids Res; METTL15 introduces N4-methylcytidine into human mitochondrial 12S rRNA and is required for mitoribosome biogenesis.; Authors - Lindsey Van Haute
mouse	WB	Aging Cell; Mitochondrial mistranslation modulated by metabolic stress causes cardiovascular disease and reduced lifespan.; Authors - Tara R Richman
human	WB	Genomics Proteomics Bioinformatics; Integrative Multi-omics Landscape of Non-structural Protein 3 of Severe Acute Respiratory Syndrome Coronaviruses.; Authors - Ruona Shi
mouse	WB	J Cell Biol; Quality control of mitochondrial protein synthesis is required for membrane integrity and cell fitness.; Authors - Uwe Richter
mouse	WB	PLoS Genet; Mutation in MRPS34 Compromises Protein Synthesis and Causes Mitochondrial Dysfunction.; Authors - Tara R Richman