MRPL27 Polyclonal antibody

MRPL27 Polyclonal Antibody for IF/ICC, ELISA
Cat No. 14765-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

MRP-L27, MRPL 27, MRP L27, L27mt, HSPC250

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

14765-1-AP targets MRPL27 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6527

Product name: Recombinant human MRPL27 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-148 aa of BC001066

Sequence: MASVVLALRTRTAVTSLLSPTPATALAVRYASKKSGGSSKNLGGKSSGRRQGIKKMEGHYVHAGNIIATQRHFRWHPGAHVGVGKNKCLYALEEGIVRYTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVHVVPAKPEGTFKLVAML

Predict reactive species
Full Name mitochondrial ribosomal protein L27
Calculated Molecular Weight 16 kDa
Observed Molecular Weight 10 kDa
GenBank Accession NumberBC001066
Gene Symbol MRPL27
Gene ID (NCBI) 51264
RRIDAB_2145890
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9P0M9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for MRPL27 antibody 14765-1-APDownload protocol
WB protocol for MRPL27 antibody 14765-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Mol Life Sci

GTPBP8 is required for mitoribosomal biogenesis and mitochondrial translation

Authors - Liang Wang
Loading...
||
New chat Able
正在加载,请稍候...