MRPL27 Polyclonal antibody

• 

  WB analysis of BxPC-3 using 14765-1-AP

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 14765-1-AP (MRPL27 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A431 using 14765-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using MRPL27 antibody (14765-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

MRPL27 Polyclonal Antibody for IF/ICC, ELISA

Cat No. 14765-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

MRP-L27, MRPL 27, MRP L27, L27mt, HSPC250

---

Tested Applications

• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

14765-1-AP targets MRPL27 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6527

  Product name: Recombinant human MRPL27 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-148 aa of BC001066

  Sequence: MASVVLALRTRTAVTSLLSPTPATALAVRYASKKSGGSSKNLGGKSSGRRQGIKKMEGHYVHAGNIIATQRHFRWHPGAHVGVGKNKCLYALEEGIVRYTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVHVVPAKPEGTFKLVAML

• Full Name: mitochondrial ribosomal protein L27
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC001066
• Gene Symbol: MRPL27
• Gene ID (NCBI): 51264
• RRID: AB_2145890
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P0M9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Mol Life Sci; GTPBP8 is required for mitoribosomal biogenesis and mitochondrial translation; Authors - Liang Wang