MRPL50 Polyclonal antibody

• 

  WB analysis using 17213-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17213-1-AP (MRPL50 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 17213-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17213-1-AP (MRPL50 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 17213-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17213-1-AP (MRPL50 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

MRPL50 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17213-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

L50mt, MRP L50, MRPL50

---

Tested Applications

• Positive WB detected in: HT-1080 cells, HeLa cells, HepG2 cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17213-1-AP targets MRPL50 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10996

  Product name: Recombinant human MRPL50 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-158 aa of BC032008

  Sequence: MAARSVSGITRRVFMWTVSGTPCREFWSRFRKEKEPVVVETVEEKKEPILVCPPLRSRAYTPPEDLQSRLESYVKEVFGSSLPSNWQDISLEDSRLKFNLLAHLADDLGHVVPNSRLHQMCRVRDVFDFYNVPIQDRSKFDELSASNLPPNLKITWSY

• Full Name: mitochondrial ribosomal protein L50
• Calculated Molecular Weight: 158 aa, 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC032008
• Gene Symbol: MRPL50
• Gene ID (NCBI): 54534
• RRID: AB_2935441
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N5N7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MRPL50, also named as L50mt, is a mitochondrial protein with MW 18 kDa.